HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
Pepti · Catalog · VIP (Vasoactive Intestinal Peptide)
Neuropeptide · VPAC1/VPAC2 agonist · research-use
VIP peptide OEM supply.
Vasoactive intestinal peptide synthesized as the C-terminally amidated 28-mer, supplied as lyophilized powder with HPLC/MS documentation for research and private-label programs.
VIPHPLC ≥ 99%MS confirmed10mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | VIP (Vasoactive Intestinal Peptide) |
|---|---|
| CAS number | 40077-57-4 |
| Molecular formula | C147H238N44O42S |
| Molecular weight | 3325.8 g/mol |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Form | Lyophilized powder, glass vial |
| Purity target | ≥ 99% by HPLC |
| Vial formats | 10mg / 5mg |
| Documentation | Batch-linked COA + HPLC chromatogram + MS identity record for every production lot |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20°C protected from light and moisture; -80°C recommended for long-term storage. After reconstitution keep at 2-8°C and use within a short window. As with all peptides, avoid repeated freeze-thaw cycles. Ships with COA. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| OEM lot | 50 kits (500 vials) | 3–7 days |
| Production lot | 500–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
Supplied as a research-use peptide. Every quote confirms current-batch COA, purity, destination market and buyer track before invoicing.
Overview
About VIP (Vasoactive Intestinal Peptide).
VIP is a 28-residue neuropeptide of the secretin/glucagon/PACAP superfamily that signals through the class-B GPCRs VPAC1 and VPAC2 to raise intracellular cAMP. In research settings it is studied as a vasodilator, smooth-muscle relaxant, and immunomodulatory/anti-inflammatory signaling molecule.
Documentation
Batch documentation support for VIP (Vasoactive Intestinal Peptide) lots.
batch-linked COA, HPLC chromatogram and MS identity record for every production lot. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the VIP (Vasoactive Intestinal Peptide) reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
VIP (Vasoactive Intestinal Peptide) — frequently asked by B2B buyers.
What form and vial sizes is VIP supplied in?
VIP is supplied as a lyophilized (freeze-dried) white powder synthesized as the C-terminally amidated 28-amino-acid sequence. Catalog fill sizes are 10mg and 5mg vials; bulk quantities and custom fill are available on RFQ.
What documentation ships with each lot?
Every production lot includes a batch-linked COA including RP-HPLC purity and mass-spectrometry (ESI-MS/MALDI) identity confirmation. Sequence data, net-peptide/counter-ion content and endotoxin (only if specifically ordered and tested) figures can be provided on request.
What is the minimum order quantity?
The standard catalog MOQ is 50 kits (500 vials). Larger bulk orders and OEM/private-label programs are quoted per RFQ, with volume pricing available.
Do you support private-label / OEM programs for VIP?
Yes. Pepti supplies VIP for private-label and OEM programs, including custom vial fill, labeling and documentation. VIP is offered for laboratory research and manufacturing use only, not for consumer or veterinary use.
How is purity verified?
Purity is verified by reversed-phase HPLC, with molecular identity confirmed by mass spectrometry against the expected amidated 28-mer mass (approximately 3325.8 g/mol). Batch-specific purity is stated on the COA.
Related compounds