HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
Follistatin-344HPLC ≥ 99%MS confirmed1mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | Follistatin-344 (FST-344) |
|---|---|
| Molecular weight | ~34.7 kDa predicted for the mature chain (aa 30-344, 315 residues) — independently computed as 34,754 Da from UniProt P19883, consistent with R&D Systems 4889-FN. Full 344-aa precursor = 38,007 Da (UniProt P19883, canonical). Apparent ~38-42 kDa on reducing SDS-PAGE for glycosylated NS0/HEK293-expressed material; non-glycosylated E. coli constructs (e.g. FST-288-type) migrate lower (~31-35 kDa). Exact MW is expression-system/glycoform dependent. |
| Sequence | GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW |
| Form | Lyophilized powder, glass vial |
| Purity target | ≥ 99% by HPLC |
| Vial formats | 1mg |
| Documentation | Batch-linked COA + HPLC chromatogram + MS identity record for every production lot |
| Distribution scope | Research use, worldwide |
| Storage | Ship and hold as lyophilized powder; store desiccated at -20°C, protected from light, for long-term stability. After reconstitution in sterile solvent, keep at 2–8°C for short-term use or aliquot and store at -20°C to limit freeze–thaw cycles. Research use only. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| OEM lot | 50 kits (500 vials) | 3–7 days |
| Production lot | 500–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
Supplied as a research-use peptide. Every quote confirms current-batch COA, purity, destination market and buyer track before invoicing.
Overview
About Follistatin-344 (FST-344).
Follistatin-344 is one of two alternatively spliced isoforms of human follistatin (UniProt P19883), a single-chain secreted glycoprotein comprising an N-terminal domain and three cysteine-rich follistatin domains (FSD1-3). In research models it acts as a high-affinity antagonist of TGF-β superfamily ligands — principally myostatin (GDF-8) and activin A/B — by binding and sequestering them, which is studied in the context of skeletal-muscle and tissue-signaling research.
Documentation
Batch documentation support for Follistatin-344 (FST-344) lots.
batch-linked COA, HPLC chromatogram and MS identity record for every production lot. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the Follistatin-344 (FST-344) reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
Follistatin-344 (FST-344) — frequently asked by B2B buyers.
What format is Follistatin-344 supplied in?
It ships as a lyophilized (freeze-dried) powder in a sealed vial, offered here at 1 mg per vial. Follistatin-344 is a recombinant single-chain glycoprotein; reconstitution solvent (for example bacteriostatic or sterile water) is not included and is selected by the receiving lab.
What documentation ships with each batch?
Every lot is supplied with a Certificate of Analysis reporting identity and purity by HPLC and mass spectrometry (MS), alongside appearance and net-content data. Additional documentation such as SDS-PAGE, endotoxin (only if specifically ordered and tested) results, or lot-specific data can be provided on request for qualification and private-label programs.
What is the minimum order quantity?
Catalog MOQ for the 1 mg format is 50 kits (500 vials). Larger bulk and private-label volumes are quoted per RFQ, and custom fill sizes, labeling, and kitting can be arranged as part of an OEM program.
Can you confirm the CAS number and molecular weight?
Follistatin-344 is a recombinant glycoprotein (human follistatin, UniProt P19883); its apparent mass runs roughly 38–42 kDa on SDS-PAGE depending on glycosylation and expression system, with a predicted mature-chain mass near 34.7 kDa. Because reported CAS designations for follistatin vary across registries, exact CAS and lot-specific mass are confirmed on the batch COA / RFQ rather than assumed.
Is Follistatin-344 sold for therapeutic use?
No. It is supplied strictly as a research-use-only material for laboratory and manufacturing R&D. It is not a drug, supplement, or medical product, and Pepti provides no dosing or medical guidance. Buyers are responsible for compliance and permitted use in their own jurisdiction.
Related compounds