HPLC purity
Reverse-phase HPLC with UV detection; purity target reported per lot with related-substance reporting on request.
ACTH 1-39HPLC ≥ 99%MS confirmed5mg
Vial illustrations reflect supplied lyophilized format. Distribution scope and destination market confirmed before invoicing.
| Compound | ACTH 1-39 |
|---|---|
| CAS number | 12279-41-3 |
| Molecular formula | C207H308N56O58S |
| Molecular weight | 4541.07 |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Form | Lyophilized powder, glass vial |
| Purity target | ≥ 99% by HPLC |
| Vial formats | 5mg |
| Documentation | Batch-linked COA + HPLC chromatogram + MS identity record for every production lot |
| Distribution scope | Research use, worldwide |
| Storage | Store lyophilized powder at -20°C, protected from light and moisture; stable for extended periods when sealed. After reconstitution, keep at 2-8°C and use within a short window, or aliquot and store frozen to avoid repeated freeze-thaw cycles. Avoid prolonged exposure to room temperature. For laboratory research use only. |
MOQ & lead time
| Tier | Quantity | Lead time |
|---|---|---|
| OEM lot | 50 kits (500 vials) | 3–7 days |
| Production lot | 500–1,000 vials | 10–14 days |
| OEM repeat | 1,000+ vials | 14–18 days, scheduled |
Supplied as a research-use peptide. Every quote confirms current-batch COA, purity, destination market and buyer track before invoicing.
Overview
About ACTH 1-39.
ACTH 1-39 is the full-length adrenocorticotropic hormone, a 39-residue peptide cleaved from the proopiomelanocortin (POMC) precursor. In research models it acts as a potent endogenous agonist at the melanocortin-2 receptor (MC2R), driving glucocorticoid synthesis and secretion in the adrenal cortex, and is widely used as a reference standard in HPA-axis and steroidogenesis studies.
Documentation
Batch documentation support for ACTH 1-39 lots.
batch-linked COA, HPLC chromatogram and MS identity record for every production lot. Distribution scope confirmed before invoicing.
MS identity
Mass spectrometry identity confirmation against the ACTH 1-39 reference profile.
Lot traceability
Compound prefix and lot serial printed on the vial label and repeated in the document pack and carton.
FAQ
ACTH 1-39 — frequently asked by B2B buyers.
What vial size and MOQ does Pepti offer for ACTH 1-39?
ACTH 1-39 is stocked as 5mg lyophilized vials with a minimum order quantity of 50 kits (500 vials). Larger volumes, bulk lyophilized powder and custom fill sizes are available on RFQ for OEM and private-label programs.
What documentation ships with each batch?
Every production lot includes a batch-linked COA covering HPLC purity and mass-spectrometry identity confirmation. Additional documentation such as residual-solvent, water-content or endotoxin (only if specifically ordered and tested) data can be provided on request to support your incoming-QC requirements.
How is identity and purity confirmed?
Identity is verified by mass spectrometry against the expected molecular weight (≈4541 g/mol) for the 39-residue sequence, and purity is quantified by RP-HPLC. Specific purity thresholds and method details are confirmed per batch on the COA.
Is this human or rat ACTH 1-39?
The standard catalog form is human ACTH 1-39 (CAS 12279-41-3, sequence SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF). The rat variant is a distinct molecule (CAS 77465-10-2); specify the species required at RFQ so the correct sequence is supplied.
Can Pepti support private-label and OEM orders?
Yes. As a China-based manufacturer and OEM supplier, Pepti supports private-label labeling, custom vial fills and bulk supply. All material is provided for research use only and is not sold for therapeutic or consumer use.
Related compounds